Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6X9E4-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
13-30 (18) IFSFLDLFGLLQVSQVNK PA
1
35-43 (9) IADSDYLWR PA
2
50-66 (17) WDCSNFTNQHLGTHTWK PA
2
79-90 (12) LALAQPHNFIYK PA
2
94-108 (15) NIAFETELAYLSGNR PA
2
109-116 (8) LTVDEQEK PA
2
117-125 (9) SIICSVSPK PA
2
126-152 (27) QELCAWDVQEVGDAAGDIYTFTLPGLR PA
0
157-173 (17) VTAFQYGIVLLHCSPDK PA
2
175-184 (10) WVFACGTYSR PA
2
185-212 (28) TLPQVFLTESLLRPSEGSVPLSTFLPHK PA
2
213-222 (10) LCASACWTPK PA
2
227-237 (11) ITLMSQSSTGK PA
2
239-249 (11) TEFITFDLTTK PA
2
251-272 (22) TGGQTVIQAYEIASFQVAAHLK PA
2
273-305 (33) CPIWMGASDGYMIVFTSGPYLLLFSITGFLLQR PA
2
306-341 (36) FEDHQAAINNFWVDPCYVLTTSENSVHVYMWEEGGR PA
2
347-377 (31) SCCHLENTWHDHTTDSCISSVMCDNASIVLR PA
2
381-394 (14) VSDSSILVMYSLNT PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center