Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6X9E4-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MSPTHQIQDPK PA
0
16-24 (9) IADSDYLWR PA
2
31-47 (17) WDCSNFTNQHLGTHTWK PA
2
60-71 (12) LALAQPHNFIYK PA
2
75-89 (15) NIAFETELAYLSGNR PA
2
90-97 (8) LTVDEQEK PA
2
98-106 (9) SIICSVSPK PA
2
107-147 (41) QELCAWDVQEGTMIWSSPVQEFHFSNLVTLPQMHLAITMDR PA
1
160-180 (21) DALAVLPMPQPCYCMEAYLTK PA
1
181-203 (23) DGPFLMVGDAAGDIYTFTLPGLR PA
1
208-224 (17) VTAFQYGIVLLHCSPDK PA
2
226-235 (10) WVFACGTYSR PA
2
236-263 (28) TLPQVFLTESLLRPSEGSVPLSTFLPHK PA
2
264-273 (10) LCASACWTPK PA
2
278-288 (11) ITLMSQSSTGK PA
2
290-300 (11) TEFITFDLTTK PA
2
302-323 (22) TGGQTVIQAYEIASFQVAAHLK PA
2
324-356 (33) CPIWMGASDGYMIVFTSGPYLLLFSITGFLLQR PA
2
357-392 (36) FEDHQAAINNFWVDPCYVLTTSENSVHVYMWEEGGR PA
2
398-428 (31) SCCHLENTWHDHTTDSCISSVMCDNASIVLR PA
2
432-445 (14) VSDSSILVMYSLNT PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center