Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6ZMU5-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-35 (35) MSAAPGLLHQELSCPLCLQLFDAPVTAECGHSFCR PA
1
41-73 (33) VAGEPAADGTVLCPCCQAPTRPQALSTNLQLAR PA
1
74-101 (28) LVEGLAQVPQGHCEEHLDPLSIYCEQDR PA
1
102-115 (14) ALVCGVCASLGSHR PA
1
119-128 (10) LLPAAEAHAR PA
1
138-146 (9) LQLQEACMR PA
1
150-166 (17) SVAVLEHQLVEVEETVR PA
1
170-178 (9) GAVGEQLGK PA
1
181-192 (12) VFLAALEGSLDR PA
1
199-206 (8) GEAGVALR PA
1
208-220 (13) ELGSLNSYLEQLR PA
1
225-240 (16) VLEEVADKPQTEFLMK PA
1
251-260 (10) ILAESPPPAR PA
1
261-269 (9) LDIQLPIIS PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center