Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6ZRS2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-85 (85) MQSSPSPAHPQLPVLQTQMVSDGMTGSNPVSPASSSSPASSGAGGISPQHIAQDSSLDGPPGPPDGATVPLEGFSLSQAA
DLANK PA
2
92-101 (10) SHAEIAEQAK PA
2
102-109 (8) HEAEIETR PA
2
127-134 (8) VPEPPRPK PA
2
135-155 (21) GHWDYLCEEMQWLSADFAQER PA
2
204-211 (8) QFWSNVEK PA
2
228-242 (15) ALDLHLDFIVGQTEK PA
2
243-259 (17) YSDLLSQSLNQPLTSSK PA
2
260-281 (22) AGSSPCLGSSSAASSPPPPASR PA
2
282-318 (37) LDDEDGDFQPQEDEEEDDEETIEVEEQQEGNDAEAQR PA
2
327-337 (11) EGELPLEELLR PA
2
338-362 (25) SLPPQLLEGPSSPSQTPSSHDSDTR PA
2
363-389 (27) DGPEEGAEEEPPQVLEIKPPPSAVTQR PA
2
392-438 (47) QPWHPDEDDEEFTANEEEAEDEEDTIAAEEQLEGEVDHAMELSELAR PA
2
439-503 (65) EGELSMEELLQQYAGAYAPGSGSSEDEDEDEVDANSSDCEPEGPVEAEEPPQEDSSSQSDSVEDR PA
2
504-557 (54) SEDEEDEHSEEEETSGSSASEESESEESEDAQSQSQADEEEEDDDFGVEYLLAR PA
2
558-581 (24) DEEQSEADAGSGPPTPGPTTLGPK PA
2
583-597 (15) EITDIAAAAESLQPK PA
2
598-607 (10) GYTLATTQVK PA
2
608-615 (8) TPIPLLLR PA
2
620-635 (16) EYQHIGLDWLVTMYEK PA
2
637-649 (13) LNGILADEMGLGK PA
2
650-664 (15) TIQTISLLAHLACEK PA
2
665-687 (23) GNWGPHLIIVPTSVMLNWEMELK PA
2
695-703 (9) ILTYYGAQK PA
2
710-726 (17) QGWTKPNAFHVCITSYK PA
2
727-736 (10) LVLQDHQAFR PA
2
742-752 (11) YLILDEAQNIK PA
2
759-769 (11) WQSLLNFNSQR PA
2
771-801 (31) LLLTGTPLQNSLMELWSLMHFLMPHVFQSHR PA
2
805-827 (23) EWFSNPLTGMIEGSQEYNEGLVK PA
2
832-839 (8) VLRPFLLR PA
9
867-879 (13) CLYDDFMAQTTTK PA
2
880-898 (19) ETLATGHFMSVINILMQLR PA
2
900-931 (32) VCNHPNLFDPRPVTSPFITPGICFSTASLVLR PA
2
932-940 (9) ATDVHPLQR PA
2
946-954 (9) FDLIGLEGR PA
2
958-966 (9) YEADTFLPR PA
2
973-991 (19) VLLEVATAPDPPPRPKPVK PA
2
1008-1016 (9) TVVVVNNPR PA
2
1017-1115 (99) APLGPVPVRPPPGPELSAQPTPGPVPQVLPASLMVSASPAGPPLIPASRPPGPVLLPPLQPNSGSLPQVLPSPLGVLSGT
SRPPTPTLSLKPTPPAPVR PA
1
1116-1168 (53) LSPAPPPGSSSLLKPLTVPPGYTFPPAAATTTSTTTATATTTAVPAPTPAPQR PA
1
1169-1178 (10) LILSPDMQAR PA
1
1179-1215 (37) LPSGEVVSIGQLASLAQRPVANAGGSKPLTFQIQGNK PA
1
1216-1224 (9) LTLTGAQVR PA
2
1225-1236 (12) QLAVGQPRPLQR PA
0
1237-1310 (74) NVVHLVSAGGQHHLISQPAHVALIQAVAPTPGPTPVSVLPSSTPSTTPAPTGLSLPLAANQVPPTMVNNTGVVK PA
0
1319-1352 (34) DGLTPVPPLAPAPRPPSSGLPAVLNPRPTLTPGR PA
2
1353-1362 (10) LPTPTLGTAR PA
2
1363-1376 (14) APMPTPTLVRPLLK PA
2
1377-1840 (464) LVHSPSPEVSASAPGAAPLTISSPLHVPSSLPGPASSPMPIPNSSPLASPVSSTVSVPLSSSLPISVPTTLPAPASAPLT
IPISAPLTVSASGPALLTSVTPPLAPVVPAAPGPPSLAPSGASPSASALTLGLATAPSLSSSQTPGHPLLLAPTSSHVPG
LNSTVAPACSPVLVPASALASPFPSAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSP
GAAPVLASSQTPVPVMAPSSTPGTSLASASPVPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQTLALAPALAPTLGGSSP
SQTLSLGTGNPQGPFPTQTLSLTPASSLVPTPAQTLSLAPGPPLGPTQTLSLAPAPPLAPASPVGPAPAHTLTLAPASSS
ASLLAPASVQTLTLSPAPVPTLGPAAAQTLALAPASTQSPASQASSLVVSASGAAPLPVTMVSR PA
2
1846-1854 (9) DEPDTLTLR PA
2
1855-1873 (19) SGPPSPPSTATSFGGPRPR PA
2
1882-1892 (11) SPFYLDSLEEK PA
2
1904-1939 (36) IFQLSEAHGALAPVYGTEVLDFCTLPQPVASPIGPR PA
2
1940-1957 (18) SPGPSHPTFWTYTEAAHR PA
2
1958-1965 (8) AVLFPQQR PA
2
1966-1975 (10) LDQLSEIIER PA
2
1976-2002 (27) FIFVMPPVEAPPPSLHACHPPPWLAPR PA
2
2003-2017 (15) QAAFQEQLASELWPR PA
2
2037-2044 (8) LIQYDCGK PA
2
2045-2053 (9) LQTLAVLLR PA
2
2062-2070 (9) VLIFTQMTR PA
2
2071-2088 (18) MLDVLEQFLTYHGHLYLR PA
2
2111-2119 (9) IFCFILSTR PA
2
2120-2151 (32) SGGVGVNLTGADTVVFYDSDWNPTMDAQAQDR PA
2
2171-2178 (8) TVEENILK PA
2
2185-2202 (18) MLGDMAIEGGNFTTAYFK PA
2
2208-2236 (29) ELFDMPLEEPSSSSVPSAPEEEEETVASK PA
2
2237-2247 (11) QTHILEQALCR PA
2
2248-2255 (8) AEDEEDIR PA
2
2262-2297 (36) AEQVAELAEFNENDGFPAGEGEEAGRPGAEDEEMSR PA
2
2298-2314 (17) AEQEIAALVEQLTPIER PA
2
2319-2329 (11) FLEASLEEVSR PA
2
2334-2343 (10) QAEEQVEAAR PA
2
2356-2380 (25) LPQEEEEGPGAGDESSCGTGGGTHR PA
2
2387-2394 (8) APERPGTR PA
2
2404-2421 (18) AETQGANHTPVISAHQTR PA
2
2436-2583 (148) VPRPAPRPRPTPASAPAAIPALVPVPVSAPVPISAPNPITILPVHILPSPPPPSQIPPCSSPACTPPPACTPPPAHTPPP
AQTCLVTPSSPLLLGPPSVPISASVTNLPLGLRPEAELCAQALASPESLELASVASSETSSLSLVPPK PA
2
2584-2598 (15) DLLPVAVEILPVSEK PA
2
2599-2672 (74) NLSLTPSAPSLTLEAGSIPNGQEQEAPDSAEGTTLTVLPEGEELPLCVSESNGLELPPSAASDEPLQEPLEADR PA
2
2673-2681 (9) TSEELTEAK PA
2
2682-2721 (40) TPTSSPEKPQELVTAEVAAPSTSSSATSSPEGPSPARPPR PA
2
2724-2731 (8) TSADVEIR PA
2
2732-2745 (14) GQGTGRPGQPPGPK PA
2
2754-2761 (8) LVTVVEEK PA
2
2772-2794 (23) GAASTLVPGVSETSASPGSPSVR PA
2
2795-2828 (34) SMSGPESSPPIGGPCEAAPSSSLPTPPQQPFIAR PA
2
2830-2857 (28) HIELGVTGGGSPENGDGALLAITPPAVK PA
2
2876-2886 (11) GVDEAPSSTLK PA
2
2889-2936 (48) TNGADPVPGPETLIVADPVLEPQLIPGPQPLGPQPVHRPNPLLSPVEK PA
2
2947-2965 (19) DLPIPGTISSAGDGNSESR PA
2
2966-3004 (39) TQPPPHPSPLTPLPPLLVCPTATVANTVTTVTISTSPPK PA
2
3013-3027 (15) NPPSPRPSQLPVLDR PA
2
3028-3040 (13) DSTSVLESCGLGR PA
2
3043-3065 (23) QPQGQGESEGSSSDEDGSRPLTR PA
2
3081-3116 (36) SGGSMVVAVIQDDLDLADSGPGGLELTPPVVSLTPK PA
2
3122-3135 (14) LRPGSLVPPLETEK PA
2
3141-3153 (13) AGAPVGGSPGLAK PA
2
3157-3188 (32) LQPPSPLGPEGSVEESEAEASGEEEEGDGTPR PA
2
3196-3206 (11) LVGTTNQGDQR PA
2
3210-3224 (15) SSAPPSLAGPAVSHR PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center