Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6ZRS2-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-85 (85) MQSSPSPAHPQLPVLQTQMVSDGMTGSNPVSPASSSSPASSGAGGISPQHIAQDSSLDGPPGPPDGATVPLEGFSLSQAA
DLANK PA
2
92-101 (10) SHAEIAEQAK PA
2
102-109 (8) HEAEIETR PA
2
127-134 (8) VPEPPRPK PA
2
135-155 (21) GHWDYLCEEMQWLSADFAQER PA
2
204-211 (8) QFWSNVEK PA
2
228-242 (15) ALDLHLDFIVGQTEK PA
2
243-259 (17) YSDLLSQSLNQPLTSSK PA
2
260-281 (22) AGSSPCLGSSSAASSPPPPASR PA
2
282-318 (37) LDDEDGDFQPQEDEEEDDEETIEVEEQQEGNDAEAQR PA
2
327-337 (11) EGELPLEELLR PA
2
338-362 (25) SLPPQLLEGPSSPSQTPSSHDSDTR PA
2
363-389 (27) DGPEEGAEEEPPQVLEIKPPPSAVTQR PA
2
392-438 (47) QPWHPDEDDEEFTANEEEAEDEEDTIAAEEQLEGEVDHAMELSELAR PA
2
439-503 (65) EGELSMEELLQQYAGAYAPGSGSSEDEDEDEVDANSSDCEPEGPVEAEEPPQEDSSSQSDSVEDR PA
2
504-557 (54) SEDEEDEHSEEEETSGSSASEESESEESEDAQSQSQADEEEEDDDFGVEYLLAR PA
2
558-581 (24) DEEQSEADAGSGPPTPGPTTLGPK PA
2
583-597 (15) EITDIAAAAESLQPK PA
2
598-607 (10) GYTLATTQVK PA
2
608-615 (8) TPIPLLLR PA
2
620-635 (16) EYQHIGLDWLVTMYEK PA
2
637-649 (13) LNGILADEMGLGK PA
2
650-664 (15) TIQTISLLAHLACEK PA
2
665-687 (23) GNWGPHLIIVPTSVMLNWEMELK PA
2
695-703 (9) ILTYYGAQK PA
2
710-726 (17) QGWTKPNAFHVCITSYK PA
2
727-736 (10) LVLQDHQAFR PA
2
742-752 (11) YLILDEAQNIK PA
2
759-769 (11) WQSLLNFNSQR PA
2
771-801 (31) LLLTGTPLQNSLMELWSLMHFLMPHVFQSHR PA
2
805-827 (23) EWFSNPLTGMIEGSQEYNEGLVK PA
2
832-839 (8) VLRPFLLR PA
9
867-879 (13) CLYDDFMAQTTTK PA
2
880-898 (19) ETLATGHFMSVINILMQLR PA
2
900-931 (32) VCNHPNLFDPRPVTSPFITPGICFSTASLVLR PA
2
932-940 (9) ATDVHPLQR PA
2
946-954 (9) FDLIGLEGR PA
2
958-966 (9) YEADTFLPR PA
2
973-991 (19) VLLEVATAPDPPPRPKPVK PA
2
1008-1016 (9) TVVVVNNPR PA
2
1017-1119 (103) APLGPVPVRPPPGPELSAQPTPGPVPQVLPASLMVSASPAGPPLIPASRPPGPVLLPPLQPNSGSLPQAGEVVSIGQLASLAQRPVANAGGSKPLTFQIQGNK PA
0
1120-1128 (9) LTLTGAQVR PA
2
1129-1152 (24) QLAVGQPRPLQMPPTMVNNTGVVK PA
1
1161-1194 (34) DGLTPVPPLAPAPRPPSSGLPAVLNPRPTLTPGR PA
2
1195-1204 (10) LPTPTLGTAR PA
2
1205-1218 (14) APMPTPTLVRPLLK PA
2
1219-1682 (464) LVHSPSPEVSASAPGAAPLTISSPLHVPSSLPGPASSPMPIPNSSPLASPVSSTVSVPLSSSLPISVPTTLPAPASAPLT
IPISAPLTVSASGPALLTSVTPPLAPVVPAAPGPPSLAPSGASPSASALTLGLATAPSLSSSQTPGHPLLLAPTSSHVPG
LNSTVAPACSPVLVPASALASPFPSAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSP
GAAPVLASSQTPVPVMAPSSTPGTSLASASPVPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQTLALAPALAPTLGGSSP
SQTLSLGTGNPQGPFPTQTLSLTPASSLVPTPAQTLSLAPGPPLGPTQTLSLAPAPPLAPASPVGPAPAHTLTLAPASSS
ASLLAPASVQTLTLSPAPVPTLGPAAAQTLALAPASTQSPASQASSLVVSASGAAPLPVTMVSR PA
2
1688-1696 (9) DEPDTLTLR PA
2
1697-1715 (19) SGPPSPPSTATSFGGPRPR PA
2
1724-1734 (11) SPFYLDSLEEK PA
2
1746-1781 (36) IFQLSEAHGALAPVYGTEVLDFCTLPQPVASPIGPR PA
2
1782-1799 (18) SPGPSHPTFWTYTEAAHR PA
2
1800-1807 (8) AVLFPQQR PA
2
1808-1817 (10) LDQLSEIIER PA
2
1818-1844 (27) FIFVMPPVEAPPPSLHACHPPPWLAPR PA
2
1845-1859 (15) QAAFQEQLASELWPR PA
2
1879-1886 (8) LIQYDCGK PA
2
1887-1895 (9) LQTLAVLLR PA
2
1904-1912 (9) VLIFTQMTR PA
2
1913-1930 (18) MLDVLEQFLTYHGHLYLR PA
2
1953-1961 (9) IFCFILSTR PA
2
1962-1993 (32) SGGVGVNLTGADTVVFYDSDWNPTMDAQAQDR PA
2
2013-2020 (8) TVEENILK PA
2
2027-2044 (18) MLGDMAIEGGNFTTAYFK PA
2
2050-2078 (29) ELFDMPLEEPSSSSVPSAPEEEEETVASK PA
2
2079-2089 (11) QTHILEQALCR PA
2
2090-2097 (8) AEDEEDIR PA
2
2104-2139 (36) AEQVAELAEFNENDGFPAGEGEEAGRPGAEDEEMSR PA
2
2140-2156 (17) AEQEIAALVEQLTPIER PA
2
2161-2171 (11) FLEASLEEVSR PA
2
2176-2185 (10) QAEEQVEAAR PA
2
2198-2222 (25) LPQEEEEGPGAGDESSCGTGGGTHR PA
2
2229-2236 (8) APERPGTR PA
2
2246-2263 (18) AETQGANHTPVISAHQTR PA
2
2278-2425 (148) VPRPAPRPRPTPASAPAAIPALVPVPVSAPVPISAPNPITILPVHILPSPPPPSQIPPCSSPACTPPPACTPPPAHTPPP
AQTCLVTPSSPLLLGPPSVPISASVTNLPLGLRPEAELCAQALASPESLELASVASSETSSLSLVPPK PA
2
2426-2440 (15) DLLPVAVEILPVSEK PA
2
2441-2514 (74) NLSLTPSAPSLTLEAGSIPNGQEQEAPDSAEGTTLTVLPEGEELPLCVSESNGLELPPSAASDEPLQEPLEADR PA
2
2515-2523 (9) TSEELTEAK PA
2
2524-2563 (40) TPTSSPEKPQELVTAEVAAPSTSSSATSSPEGPSPARPPR PA
2
2566-2573 (8) TSADVEIR PA
2
2574-2587 (14) GQGTGRPGQPPGPK PA
2
2596-2603 (8) LVTVVEEK PA
2
2614-2636 (23) GAASTLVPGVSETSASPGSPSVR PA
2
2637-2670 (34) SMSGPESSPPIGGPCEAAPSSSLPTPPQQPFIAR PA
2
2672-2699 (28) HIELGVTGGGSPENGDGALLAITPPAVK PA
2
2718-2728 (11) GVDEAPSSTLK PA
2
2731-2778 (48) TNGADPVPGPETLIVADPVLEPQLIPGPQPLGPQPVHRPNPLLSPVEK PA
2
2789-2807 (19) DLPIPGTISSAGDGNSESR PA
2
2808-2846 (39) TQPPPHPSPLTPLPPLLVCPTATVANTVTTVTISTSPPK PA
2
2855-2869 (15) NPPSPRPSQLPVLDR PA
2
2870-2882 (13) DSTSVLESCGLGR PA
2
2885-2907 (23) QPQGQGESEGSSSDEDGSRPLTR PA
2
2923-2958 (36) SGGSMVVAVIQDDLDLADSGPGGLELTPPVVSLTPK PA
2
2964-2977 (14) LRPGSLVPPLETEK PA
2
2983-2995 (13) AGAPVGGSPGLAK PA
2
2999-3030 (32) LQPPSPLGPEGSVEESEAEASGEEEEGDGTPR PA
2
3038-3048 (11) LVGTTNQGDQR PA
2
3052-3066 (15) SSAPPSLAGPAVSHR PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center