Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6ZS11-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-17 (10) APEVPTEGVR PA
0
18-25 (8) LVPPQVNK PA
0
29-42 (14) TPLGVLSTLEPLTR PA
0
46-77 (32) TWGVWHVPELDTQDAEALVGLWPLGSFLVTGR PA
0
78-86 (9) DPSQALVLR PA
0
87-101 (15) SGPLPGEVNTYQIQK PA
0
105-129 (25) GVSLESSNLCMPDLPHLLAFLSASR PA
0
135-146 (12) TLLLPPPTLGPR PA
1
147-157 (11) DEHTDPVQIGR PA
1
158-165 (8) VQQDTPGK PA
1
166-179 (14) VLSIVNQLYLETHR PA
1
184-197 (14) EQTPQETEPEAAQR PA
1
204-214 (11) NPAPHGVSWVK PA
1
215-242 (28) GPLSPEVDHPGPALASLLEEEEEDLEGK PA
1
247-268 (22) EDDPEEEGPEDVLTIHVQSLVR PA
1
285-307 (23) IASDSGGPHGSGDPATELLQDVR PA
1
308-319 (12) HLLTDLQDHLAK PA
1
338-364 (27) DEDPGPALETAVCQAVLAPLKPALWTR PA
1
385-407 (23) AGAGPPGAQGPGPEGQSPAPALR PA
1
414-424 (11) LAHLHAACAPR PA
1
427-435 (9) VALLLEVCR PA
1
436-443 (8) DVYAGLAR PA
1
444-489 (46) GENQDPLGADAFLPALTEELIWSPDIGDTQLDVEFLMELLDPDELR PA
1
490-515 (26) GEAGYYLTTWFGALHHIAHYQPETDR PA
1
526-533 (8) ASLHQWHR PA
1
545-552 (8) AQANLPFK PA
1
553-566 (14) EPWAEETVTGTSDN PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center