Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6ZS11-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-15 (15) MPDLPHLLAFLSASR PA
0
21-32 (12) TLLLPPPTLGPR PA
1
33-43 (11) DEHTDPVQIGR PA
1
44-51 (8) VQQDTPGK PA
1
52-65 (14) VLSIVNQLYLETHR PA
1
70-83 (14) EQTPQETEPEAAQR PA
1
90-100 (11) NPAPHGVSWVK PA
1
101-128 (28) GPLSPEVDHPGPALASLLEEEEEDLEGK PA
1
133-154 (22) EDDPEEEGPEDVLTIHVQSLVR PA
1
171-193 (23) IASDSGGPHGSGDPATELLQDVR PA
1
194-205 (12) HLLTDLQDHLAK PA
1
224-250 (27) DEDPGPALETAVCQAVLAPLKPALWTR PA
1
271-293 (23) AGAGPPGAQGPGPEGQSPAPALR PA
1
300-310 (11) LAHLHAACAPR PA
1
313-321 (9) VALLLEVCR PA
1
322-329 (8) DVYAGLAR PA
1
330-375 (46) GENQDPLGADAFLPALTEELIWSPDIGDTQLDVEFLMELLDPDELR PA
1
376-401 (26) GEAGYYLTTWFGALHHIAHYQPETDR PA
1
412-419 (8) ASLHQWHR PA
1
431-438 (8) AQANLPFK PA
1
439-452 (14) EPWAEETVTGTSDN PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center