Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6ZSS3-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-33 (33) MLQTTWPQESVTFEDVAVYFTQNQWASLDPAQR PA
1
34-66 (33) ALYGEVMLENYANVASLVAFPFPKPALISHLER PA
1
67-82 (16) GEAPWGPDPWDTEILR PA
1
83-93 (11) GISQGGESWIK PA
1
101-111 (11) QEASEETELHR PA
1
112-119 (8) MPVGGLLR PA
1
120-128 (9) NVSQHFDFK PA
1
134-145 (12) QTFNLNPNLILR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center