Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6ZSZ6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
12-22 (11) SAAYVPEEELK PA
0
23-54 (32) AAEIDEEHVEDDGLSLDIQESEYMCNEETEIK PA
0
55-89 (35) EAQSYQNSPVSSATNQDAGYGSPFSESSDQLAHFK PA
1
98-117 (20) EDPQCPDSVSYPQDSLAQIK PA
1
118-137 (20) AVYANLFSESCWSSLALDLK PA
1
139-151 (13) SGSTTSTNDASQK PA
1
152-206 (55) ESSAPTPTPPTCPVSTTGPTTSTPSTSCSSSTSHSSTTSTSSSSGYDWHQAALAK PA
1
207-230 (24) TLQQTSSYGLLPEPSLFSTVQLYR PA
1
235-245 (11) LYGSVFTGASK PA
1
250-272 (23) DCSAAYDTLVELTVHMNETGHYR PA
2
293-300 (8) SLMEMEGK PA
1
309-328 (20) CMYCGHSFESLQDLSVHMIK PA
2
339-346 (8) EPVPAITK PA
1
355-381 (27) ALQDLAPPCSPEPAGMAAEVALSESAK PA
1
385-395 (11) AANPYVTPNNR PA
1
396-411 (16) YGYQNGASYTWQFEAR PA
1
418-443 (26) CMECGSSHDTLQQLTAHMMVTGHFLK PA
1
454-464 (11) QLVLDPVVEEK PA
1
465-477 (13) IQSIPLPPTTHTR PA
1
486-499 (14) QPDSPAGSTTSEEK PA
1
505-515 (11) EKPPVAGDAEK PA
1
518-526 (9) EESEDSLEK PA
1
527-537 (11) FEPSTLYPYLR PA
1
538-546 (9) EEDLDDSPK PA
1
554-565 (12) SLENTVSTAISK PA
1
566-610 (45) AQNGAPSWGGYPSIHAAYQLPGTVKPLPAAVQSVQVQPSYAGGVK PA
1
611-633 (23) SLSSAEHNALLHSPGSLTPPPHK PA
1
634-645 (12) SNVSAMEELVEK PA
1
683-692 (10) TEEVSGKPQK PA
1
694-701 (8) GPEAETGK PA
1
705-720 (16) EGPLDVHTPNGTEPLK PA
1
723-759 (37) VTNGCNNLGIIMDHSPEPSFINPLSALQSIMNTHLGK PA
1
760-776 (17) VSKPVSPSLDPLAMLYK PA
1
777-793 (17) ISNSMLDKPVYPATPVK PA
1
801-814 (14) YYYENSDQPIDLTK PA
1
817-833 (17) NKPLVSSVADSVASPLR PA
1
834-845 (12) ESALMDISDMVK PA
1
855-864 (10) SSTPSTVSEK PA
1
865-884 (20) SDADGSSFEEALDELSPVHK PA
1
889-909 (21) QSNWNPQHLLILQAQFASSLR PA
1
916-926 (11) YIMSDLGPQER PA
1
932-948 (17) FTGLSMTTISHWLANVK PA
4
962-980 (19) NLDTGHPVFFCNDCASQFR PA
1
981-998 (18) TASTYISHLETHLGFSLK PA
1
1003-1016 (14) LPLNQIQEQQNVSK PA
1
1022-1040 (19) TLGPLGATEEDLGSTFQCK PA
1
1063-1076 (14) SPEDHLIYVTELEK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center