Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6ZTC4-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MQLGEHTHPQK PA
0
15-31 (17) SLAGCLLPNPHPQLQLR PA
0
43-100 (58) NPWCHPQAPGGSSTWAPSLPPILAPQAYLNFAPPTLVPGGSPGTEAQPVAPANALGSR PA
0
103-137 (35) LNLTQPSCLSSGSHLPLPFPAGMCPHPANPTWALR PA
0
139-152 (14) GAEVPQGPPLSHTR PA
0
154-171 (18) ALCLAASGVGALLLEVPR PA
0
172-199 (28) HPGWGQQSAAGFQQVFQEGAGTHFPSVR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center