Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6ZUG5-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
19-45 (27) GEPHGTHVYFQDINVIFLGALHPSDLR PA
0
46-60 (15) EYLEGPPMVVEVHDR PA
0
64-92 (29) SEECSQKPVLFGEDPLDSYLNFQALISPR PA
0
93-104 (12) ETENNPFESQNK PA
0
105-124 (20) MWYPYGIAQVSFADLLLGHK PA
0
125-147 (23) YLNLAVPIHSCEVQPTHCGQDSR PA
0
151-158 (8) VVGLGVPR PA
0
159-168 (10) DGHQHGPMPR PA
0
169-179 (11) GNYLEADSQLK PA
0
182-189 (8) VDIAVPLR PA
0
194-206 (13) AADPDLGGSQFGR PA
0
207-214 (8) IIFVFDFK PA
0
216-232 (17) VSLLHSLLQDITMINAK PA
0
233-242 (10) ALGLDSYPVR PA
0
243-252 (10) TLQQILSAFK PA
0
257-275 (19) VQEQQHLDVLTGFHLLDGK PA
0
276-290 (15) THLFILEGLADQGLR PA
0
291-302 (12) QLWENHQSWIPR PA
0
310-319 (10) VLYNSQLLFR PA
0
322-351 (30) LYGDLEAILYHVHLFQPTELLLQQAVFFLR PA
0
365-381 (17) IHDICYNSTTLWDVTVR PA
0
382-391 (10) DLLPSSAMIK PA
0
392-410 (19) DLSQEFGMPLSQEELTDEK PA
0
411-428 (18) LFALPPQPAPNLEDYHSR PA
0
429-443 (15) NSTLTLEIHAHQEPR PA
0
446-463 (18) FTYSQDYLSAMVEPLDLK PA
0
482-500 (19) GFQVTGLQSDTESSFQDLK PA
0
513-527 (15) ENSLFANVLEPVLDR PA
0
535-543 (9) HHVDFDLYK PA
0
544-563 (20) KPPPFLELLPSPAPKPVTVR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center