Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6ZVQ6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-31 (25) SPLTQSISCVCLPELGALWEIESAR PA
0
44-53 (10) EMESSPRPHR PA
0
100-107 (8) WAAVPAGK PA
0
108-147 (40) CSQHQGLSAVATASPGVFWEMEFDVSSPLTEGAGSPMSSK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center