Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6ZVT6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-23 (18) IWCNLCIDLVAFTSEIFK PA
1
24-40 (17) GAVFQSLDGIVVSANCK PA
1
49-57 (9) SKPQDTADK PA
1
58-76 (19) DAVYGVPFSTDEPTDIIPR PA
1
77-95 (19) SCQLMTDVPHVTQLLNMTK PA
1
110-119 (10) SAESDQFINR PA
1
129-140 (12) NQDVCHIAFGSK PA
1
141-150 (10) VLGPPPLSGR PA
1
171-179 (9) SCQPSTVEK PA
1
180-200 (21) CVNGTEMSALLIPESEEQGNK PA
1
208-232 (25) QTVPIHAANLHIMHPHPPQEPSADK PA
1
249-261 (13) TETPSGSSSGNNR PA
1
266-313 (48) ASTILTTVSQQGAELLNSGTLGPQSPDQSDEWIFPENADHISYLASSR PA
1
314-334 (21) QSLLLGDDSCNPSHLWLEASK PA
1
335-350 (16) ESEHDQQAEESQSVPK PA
1
351-360 (10) DIFTFSSRPR PA
1
367-382 (16) TQTMSPEELSFILDLK PA
1
383-390 (8) EDNSVTSR PA
1
391-415 (25) DTQSEDDFYGGDSSEEGNHSIQGSR PA
0
416-435 (20) GPTTGPSELTQLTLESLLGK PA
0
447-467 (21) SAYTEAGATESQDSSMEQIDR PA
0
468-485 (18) NNFEMSLLPTTCLSPTGR PA
0
502-514 (13) DLSAQQVPASLNK PA
0
525-537 (13) LSSIPEASEYDWR PA
0
538-556 (19) NYQPSQMSESELQMLASLR PA
1
557-606 (50) WQQNEELEDAGTSHGLSASQVDNCNVSISTSSDDTTTWNSCLPPPVNQGR PA
1
611-621 (11) EMNPPSPSNPR PA
1
622-684 (63) DWLNMLSPPIVPPSQQPAEQRPDSCESLSVQGEEDLSVEEDEEVLTLLYDPCLNCYFDPQTGK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center