Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q6ZVW7-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-28 (25) SVLEALTSSTAMQCVPSDGCAMLLR PA
0
31-38 (8) ASITLHER PA
0
41-63 (23) GLEACAMSLDTQETQCQSVWVAR PA
0
68-94 (27) QQGGQQLQVHFGCFAVSVAQHLYVTLR PA
0
95-107 (13) TIPHFCGVQLDQR PA
0
125-132 (8) AILVQVPR PA
0
133-142 (10) ASGSPDYYLR PA
0
148-158 (11) FTCEDAGAPVR PA
0
159-192 (34) VTANSVSQAVFLPYSQELPCLCLEGWSATPDAVR PA
0
193-246 (54) IQICPFENDTEALEVLWDTVYYHPESQTLSWEPACPVSGHVSLCWRPGPGAGCR PA
0
248-257 (10) LQQSSQLVHR PA
0
259-273 (15) VQYPLVDTQPQLCLK PA
0
274-283 (10) FSTSWGSWVR PA
0
291-298 (8) FPTPPTSR PA
0
299-320 (22) CTCVTGGSHSSLPANAHSRPAR PA
0
321-336 (16) SLQPQVTWQPPLLLPS PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center