Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q719H9-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MSRPLITR PA
0
9-27 (19) SPASPLNNQGIPTPAQLTK PA
0
28-50 (23) SNAPVHIDVGGHMYTSSLATLTK PA
2
59-72 (14) LFDGTEPIVLDSLK PA
0
96-103 (8) LLIPDDFK PA
0
104-113 (10) DYTLLYEEAK PA
0
114-126 (13) YFQLQPMLLEMER PA
0
136-146 (11) FSRPCECLVVR PA
0
147-154 (8) VAPDLGER PA
0
162-192 (31) SLIEEVFPEIGDVMCNSVNAGWNHDSTHVIR PA
0
193-209 (17) FPLNGYCHLNSVQVLER PA
0
214-236 (23) GFEIVGSCGGGVDSSQFSEYVLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center