Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q76KX8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-23 (23) MALTQGQLSFSDVAIEFSQEEWK PA
1
35-42 (8) DVMLENYR PA
74
43-76 (34) NLVSLGEDNVRPEACICSGICLPDLSVTSMLEQK PA
0
78-87 (10) DPWTLQSEVK PA
1
88-95 (8) IINNPDGR PA
1
109-116 (8) LGSSAGNK PA
1
120-140 (21) NQHGLTLQLHLTEWQPFQAVR PA
1
151-169 (19) SISDNSSVSPVQISFFSVK PA
1
170-177 (8) THIFNNYR PA
1
178-191 (14) NDFLFSTLLPQEQK PA
1
196-206 (11) EKPYGCNEHGK PA
1
210-217 (8) VSSSLTNR PA
1
218-225 (8) QVIHIADK PA
1
229-247 (19) CSDCGEIFSSNSNFAQHQR PA
1
248-256 (9) IHTGEKPYK PA
242
263-275 (13) VFNQNSHLAQHQK PA
1
276-286 (11) IHTGQKPYNNK PA
1
291-302 (12) VFSHHAYLAQHR PA
1
304-312 (9) IHTGEKPYK PA
242
319-342 (24) AFSVCSSLTAHLVIHTGEKPYDCK PA
1
352-368 (17) SSLTTHQTVHTGERPYK PA
1
388-396 (9) VHTGEKPYK PA
80
434-458 (25) TCSDLTAHLLIHTGEKPYECIDCGK PA
1
464-471 (8) SSLTYHCR PA
1
472-480 (9) IHTGEKPYK PA
242
487-496 (10) VFSQNSNLQR PA
1
518-526 (9) QNSHLAQHR PA
1
527-542 (16) DIHTGEKPYSCNECGK PA
1
555-570 (16) NVHTGEKPYSCNECGK PA
1
583-598 (16) NIHTGEKPHSCNECGK PA
1
639-654 (16) NIHTGVKPYSCNECGK PA
1
659-671 (13) NSILVQHCSIHTR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center