Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q76LX8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
10-57 (48) CPPLCVAGILACGFLLGCWGPSHFQQSCLQALEPQAVSSYLSPGAPLK PA
2
58-67 (10) GRPPSPGFQR PA
2
75-102 (28) AAGGILHLELLVAVGPDVFQAHQEDTER PA
2
103-116 (14) YVLTNLNIGAELLR PA
2
117-125 (9) DPSLGAQFR PA
2
131-180 (50) MVILTEPEGAPNITANLTSSLLSVCGWSQTINPEDDTDPGHADLVLYITR PA
2
181-190 (10) FDLELPDGNR PA
2
194-257 (64) GVTQLGGACSPTWSCLITEDTGFDLGVTIAHEIGHSFGLEHDGAPGSGCGPSGHVMASDGAAPR PA
2
258-267 (10) AGLAWSPCSR PA
2
269-278 (10) QLLSLLSAGR PA
1
281-312 (32) CVWDPPRPQPGSAGHPPDAQPGLYYSANEQCR PA
1
319-326 (8) AVACTFAR PA
2
327-349 (23) EHLDMCQALSCHTDPLDQSSCSR PA
2
350-364 (15) LLVPLLDGTECGVEK PA
3
373-386 (14) SLVELTPIAAVHGR PA
3
399-407 (9) SCGGGVVTR PA
3
410-421 (12) QCNNPRPAFGGR PA
3
422-440 (19) ACVGADLQAEMCNTQACEK PA
3
441-452 (12) TQLEFMSQQCAR PA
3
460-484 (25) SSPGGASFYHWGAAVPHSQGDALCR PA
3
489-497 (9) AIGESFIMK PA
3
499-507 (9) GDSFLDGTR PA
3
515-528 (14) EDGTLSLCVSGSCR PA
3
536-544 (9) MDSQQVWDR PA
3
545-558 (14) CQVCGGDNSTCSPR PA
3
569-598 (30) EYVTFLTVTPNLTSVYIANHRPLFTHLAVR PA
3
609-625 (17) MSISPNTTYPSLLEDGR PA
3
645-659 (15) IWGPLQEDADIQVYR PA
2
661-683 (23) YGEEYGNLTRPDITFTYFQPKPR PA
2
684-692 (9) QAWVWAAVR PA
2
693-704 (12) GPCSVSCGAGLR PA
2
705-715 (11) WVNYSCLDQAR PA
2
717-763 (47) ELVETVQCQGSQQPPAWPEACVLEPCPPYWAVGDFGPCSASCGGGLR PA
2
769-778 (10) CVEAQGSLLK PA
2
787-807 (21) AGAQQPAVALETCNPQPCPAR PA
2
808-852 (45) WEVSEPSSCTSAGGAGLALENETCVPGADGLEAPVTEGPGSVDEK PA
2
853-879 (27) LPAPEPCVGMSCPPGWGHLDATSAGEK PA
2
880-888 (9) APSPWGSIR PA
2
889-910 (22) TGAQAAHVWTPAAGSCSVSCGR PA
2
917-925 (9) FLCMDSALR PA
2
926-942 (17) VPVQEELCGLASKPGSR PA
2
944-954 (11) EVCQAVPCPAR PA
2
959-968 (10) LAACSVSCGR PA
2
980-1015 (36) AHGEDDGEEILLDTQCQGLPRPEPQEACSLEPCPPR PA
2
1018-1034 (17) VMSLGPCSASCGLGTAR PA
2
1036-1075 (40) SVACVQLDQGQDVEVDEAACAALVRPEASVPCLIADCTYR PA
2
1076-1094 (19) WHVGTWMECSVSCGDGIQR PA
2
1097-1123 (27) DTCLGPQAQAPVPADFCQHLPKPVTVR PA
2
1124-1149 (26) GCWAGPCVGQGTPSLVPHEEAAAPGR PA
0
1150-1165 (16) TTATPAGASLEWSQAR PA
0
1166-1176 (11) GLLFSPAPQPR PA
0
1178-1194 (17) LLPGPQENSVQSSACGR PA
0
1195-1206 (12) QHLEPTGTIDMR PA
2
1207-1228 (22) GPGQADCAVAIGRPLGEVVTLR PA
2
1229-1247 (19) VLESSLNCSAGDMLLLWGR PA
2
1257-1265 (9) LLDMTFSSK PA
2
1275-1285 (11) CGRPGGGVLLR PA
2
1286-1297 (12) YGSQLAPETFYR PA
2
1298-1326 (29) ECDMQLFGPWGEIVSPSLSPATSNAGGCR PA
2
1327-1336 (10) LFINVAPHAR PA
2
1337-1361 (25) IAIHALATNMGAGTEGANASYILIR PA
2
1368-1396 (29) TTAFHGQQVLYWESESSQAEMEFSEGFLK PA
2
1403-1422 (20) GQYWTLQSWVPEMQDPQSWK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center