Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q76LX8-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
10-57 (48) CPPLCVAGILACGFLLGCWGPSHFQQSCLQALEPQAVSSYLSPGAPLK PA
2
58-67 (10) GRPPSPGFQR PA
2
75-102 (28) AAGGILHLELLVAVGPDVFQAHQEDTER PA
2
103-116 (14) YVLTNLNIGAELLR PA
2
117-125 (9) DPSLGAQFR PA
2
131-180 (50) MVILTEPEGAPNITANLTSSLLSVCGWSQTINPEDDTDPGHADLVLYITR PA
2
181-190 (10) FDLELPDGNR PA
2
194-257 (64) GVTQLGGACSPTWSCLITEDTGFDLGVTIAHEIGHSFGLEHDGAPGSGCGPSGHVMASDGAAPR PA
2
258-267 (10) AGLAWSPCSR PA
2
269-281 (13) QLLSLLSANEQCR PA
0
288-295 (8) AVACTFAR PA
2
296-318 (23) EHLDMCQALSCHTDPLDQSSCSR PA
2
319-333 (15) LLVPLLDGTECGVEK PA
3
342-355 (14) SLVELTPIAAVHGR PA
3
368-376 (9) SCGGGVVTR PA
3
379-390 (12) QCNNPRPAFGGR PA
3
391-409 (19) ACVGADLQAEMCNTQACEK PA
3
410-421 (12) TQLEFMSQQCAR PA
3
429-453 (25) SSPGGASFYHWGAAVPHSQGDALCR PA
3
458-466 (9) AIGESFIMK PA
3
468-476 (9) GDSFLDGTR PA
3
484-497 (14) EDGTLSLCVSGSCR PA
3
505-513 (9) MDSQQVWDR PA
3
514-527 (14) CQVCGGDNSTCSPR PA
3
538-567 (30) EYVTFLTVTPNLTSVYIANHRPLFTHLAVR PA
3
578-594 (17) MSISPNTTYPSLLEDGR PA
3
614-628 (15) IWGPLQEDADIQVYR PA
2
630-652 (23) YGEEYGNLTRPDITFTYFQPKPR PA
2
653-661 (9) QAWVWAAVR PA
2
662-673 (12) GPCSVSCGAGLR PA
2
674-684 (11) WVNYSCLDQAR PA
2
686-732 (47) ELVETVQCQGSQQPPAWPEACVLEPCPPYWAVGDFGPCSASCGGGLR PA
2
738-747 (10) CVEAQGSLLK PA
2
756-776 (21) AGAQQPAVALETCNPQPCPAR PA
2
777-821 (45) WEVSEPSSCTSAGGAGLALENETCVPGADGLEAPVTEGPGSVDEK PA
2
822-848 (27) LPAPEPCVGMSCPPGWGHLDATSAGEK PA
2
849-857 (9) APSPWGSIR PA
2
858-879 (22) TGAQAAHVWTPAAGSCSVSCGR PA
2
886-894 (9) FLCMDSALR PA
2
895-911 (17) VPVQEELCGLASKPGSR PA
2
913-923 (11) EVCQAVPCPAR PA
2
928-937 (10) LAACSVSCGR PA
2
949-984 (36) AHGEDDGEEILLDTQCQGLPRPEPQEACSLEPCPPR PA
2
987-1003 (17) VMSLGPCSASCGLGTAR PA
2
1005-1044 (40) SVACVQLDQGQDVEVDEAACAALVRPEASVPCLIADCTYR PA
2
1045-1063 (19) WHVGTWMECSVSCGDGIQR PA
2
1066-1092 (27) DTCLGPQAQAPVPADFCQHLPKPVTVR PA
2
1093-1107 (15) GCWAGPCVGQGACGR PA
1
1108-1119 (12) QHLEPTGTIDMR PA
2
1120-1141 (22) GPGQADCAVAIGRPLGEVVTLR PA
2
1142-1160 (19) VLESSLNCSAGDMLLLWGR PA
2
1170-1178 (9) LLDMTFSSK PA
2
1188-1198 (11) CGRPGGGVLLR PA
2
1199-1210 (12) YGSQLAPETFYR PA
2
1211-1239 (29) ECDMQLFGPWGEIVSPSLSPATSNAGGCR PA
2
1240-1249 (10) LFINVAPHAR PA
2
1250-1274 (25) IAIHALATNMGAGTEGANASYILIR PA
2
1281-1309 (29) TTAFHGQQVLYWESESSQAEMEFSEGFLK PA
2
1316-1335 (20) GQYWTLQSWVPEMQDPQSWK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center