Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q7L1S5-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MQPSEMVMNPK PA
1
12-42 (31) QVFLSVLIFGVAGLLLFMYLQVWIEEQHTGR PA
1
51-59 (9) VTSGWGPVK PA
1
73-83 (11) IQEHITNQNPK PA
0
84-91 (8) FHMPEDVR PA
0
95-103 (9) ENLLLNSER PA
0
111-123 (13) TSHSQGGDQALSK PA
0
124-131 (8) STGSPTEK PA
0
146-160 (15) FSNMNWPVDIHPLNK PA
0
180-187 (8) SFLQEFCK PA
0
189-205 (17) YGGVSHHQSHLFHTVSR PA
0
214-221 (8) ILYCEVPK PA
0
230-253 (24) ILMVLNGLASSAYNISHNAVHYGK PA
0
294-307 (14) FEHPNSYYHPVFGK PA
1
313-329 (17) YRPNACEEALINGSGVK PA
0
332-352 (21) EFIHYLLDSHRPVGMDIHWEK PA
0
356-369 (14) LCYPCLINYDFVGK PA
0
370-388 (19) FETLEEDANYFLQMIGAPK PA
0
423-443 (21) QLIYDFYYLDYLMFNYTTPFL PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center