Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q7L273-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-13 (10) VTLFLNGSPK PA
0
17-34 (18) VVAVYGTLSDLLSVASSK PA
0
39-46 (8) ATSVYNGK PA
0
47-57 (11) GGLIDDIALIR PA
0
58-98 (41) DDDVLFVCEGEPFIDPQTDSKPPEGLLGFHTDWLTLNVGGR PA
0
111-121 (11) EPDSMLAHMFK PA
0
141-153 (13) SPEYFEPILNYLR PA
0
154-173 (20) HGQLIVNDGINLLGVLEEAR PA
0
174-189 (16) FFGIDSLIEHLEVAIK PA
0
190-202 (13) NSQPPEDHSPISR PA
0
208-215 (8) FLLATPTK PA
0
220-232 (13) CQGLNFSGADLSR PA
0
248-262 (15) CNLAHANLCCANLER PA
0
263-279 (17) ADLSGSVLDCANLQGVK PA
0
280-291 (12) MLCSNAEGASLK PA
0
292-302 (11) LCNFEDPSGLK PA
0
303-311 (9) ANLEGANLK PA
0
312-326 (15) GVDMEGSQMTGINLR PA
0
342-366 (25) GATLAGTDLENCDLSGCDLQEANLR PA
0
372-389 (18) GAIFEEMLTPLHMSQSVR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center