Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q7L4P6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-22 (16) FLEDNVCYALPVSCVR PA
0
43-56 (14) GPEELGAGPESPPR PA
0
60-68 (9) DWGALLLHK PA
0
69-78 (10) AQILALAEDK PA
0
79-88 (10) SDLENSVMQK PA
0
95-107 (13) LSLNHVEEDGEVK PA
0
108-117 (10) DYGEEDLQLR PA
0
126-133 (8) KPSEVAHK PA
0
134-141 (8) SIEAVVAR PA
0
145-180 (36) QNGLSLGHSTCPEEVFVEASPGTEDMDSLEDAVVPR PA
0
181-188 (8) ALYEELLR PA
1
189-198 (10) NYQQQQEEMR PA
1
199-206 (8) HLQQELER PA
1
220-229 (10) EYGALVSEMK PA
1
238-245 (8) LQDVLLLR PA
1
246-256 (11) LGSGPAIDLEK PA
1
259-269 (11) SECLEPEPELR PA
1
270-291 (22) STFSEEANTSSYYPAPAPVMDK PA
1
299-311 (13) VHLGSGIWVDEEK PA
1
312-323 (12) WHQLQVTQGDSK PA
1
327-339 (13) NLAVMIWGTDVLK PA
1
342-349 (8) SVTGVATK PA
1
353-364 (12) DAVPKPPLSPHK PA
1
376-389 (14) IAQETVDETEIAQR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center