Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q7L5L3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-16 (12) SDLLELDCQLTR PA
1
19-30 (12) VVVVSHDENLCR PA
1
37-50 (14) DVGSLDFEDLPLYK PA
1
53-68 (16) LEVYFSPGHFAHGSDR PA
1
83-90 (8) TPMSVEIK PA
1
110-119 (10) NEITIWASEK PA
1
128-141 (14) AANPEMPLSFTISR PA
1
142-162 (21) GFWVLLSYYLGLLPFIPIPEK PA
1
163-174 (12) FFFCFLPNIINR PA
1
175-193 (19) TYFPFSCSCLNQLLAVVSK PA
1
209-243 (35) GVQVVFWCLNEESDFEAAFSVGATGVITDYPTALR PA
1
244-254 (11) HYLDNHGPAAR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center