Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q7L5L3-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-24 (24) MSLLLYYALPALGSYAMLSIFFLR PA
0
25-33 (9) RPHLLHTPR PA
0
46-66 (21) GGSGELLENTMEAMENSMAQR PA
0
67-78 (12) SDLLELDCQLTR PA
1
81-92 (12) VVVVSHDENLCR PA
1
99-112 (14) DVGSLDFEDLPLYK PA
1
115-130 (16) LEVYFSPGHFAHGSDR PA
1
145-152 (8) TPMSVEIK PA
1
172-181 (10) NEITIWASEK PA
1
190-203 (14) AANPEMPLSFTISR PA
1
204-224 (21) GFWVLLSYYLGLLPFIPIPEK PA
1
225-236 (12) FFFCFLPNIINR PA
1
237-255 (19) TYFPFSCSCLNQLLAVVSK PA
1
271-305 (35) GVQVVFWCLNEESDFEAAFSVGATGVITDYPTALR PA
1
306-316 (11) HYLDNHGPAAR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center