Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q7LBR1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
50-57 (8) IHAENAIR PA
0
60-67 (8) NQAVNFLR PA
0
79-87 (9) VQTAVTMGK PA
0
118-191 (74) FEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center