Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q7RTR8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-37 (30) IFLILAIAEFIISMLGNVFIGLVNCSEGIK PA
0
41-80 (40) VFSADFILTCLAISTIGQLLVILFDSFLVGLASHLYTTYR PA
0
84-110 (27) TVIMLWHMTNHLTTWLATCLSIFYFFK PA
0
111-123 (13) IAHFPHSLFLWLR PA
0
126-161 (36) MNGMIVMLLILSLFLLIFDSLVLEIFIDISLNIIDK PA
0
162-172 (11) SNLTLYLDESK PA
0
183-209 (27) TLLSLTSFIPFSLFLTSLLFLFLSLVR PA
0
223-230 (8) DSSTEAHR PA
0
235-264 (30) MVMSFLFLFIVHFFSLQVANGIFFMLWNNK PA
0
268-290 (23) FVMLALNAFPSCHSFILILGNSK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center