Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q7Z3C6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MAQFDTEYQR PA
1
11-34 (24) LEASYSDSPPGEEDLLVHVAEGSK PA
1
35-49 (15) SPWHHIENLDLFFSR PA
1
57-96 (40) NGFTCMLIGEIFELMQFLFVVAFTTFLVSCVDYDILFANK PA
1
97-109 (13) MVNHSLHPTEPVK PA
2
110-125 (16) VTLPDAFLPAQVCSAR PA
2
126-146 (21) IQENGSLITILVIAGVFWIHR PA
2
150-169 (20) FIYNICCYWEIHSFYLHALR PA
2
170-186 (17) IPMSALPYCTWQEVQAR PA
2
193-200 (8) EHQICIHK PA
2
202-211 (10) ELTELDIYHR PA
2
215-225 (11) FQNYMVALVNK PA
2
234-245 (12) LPGLGEAVFFTR PA
2
249-270 (22) YNFELILFWGPGSLFLNEWSLK PA
2
290-321 (32) ILWIGIANFLLCPLILIWQILYAFFSYAEVLK PA
2
323-330 (8) EPGALGAR PA
3
342-353 (12) HFNELEHELQSR PA
2
364-378 (15) YMNCFLSPLLTLLAK PA
2
379-422 (44) NGAFFAGSILAVLIALTIYDEDVLAVEHVLTTVTLLGVTVTVCR PA
2
423-439 (17) SFIPDQHMVFCPEQLLR PA
2
440-458 (19) VILAHIHYMPDHWQGNAHR PA
1
463-472 (10) DEFAQLFQYK PA
1
473-497 (25) AVFILEELLSPIVTPLILIFCLRPR PA
1
498-506 (9) ALEIIDFFR PA
1
507-527 (21) NFTVEVVGVGDTCSFAQMDVR PA
1
528-552 (25) QHGHPQWLSAGQTEASVYQQAEDGK PA
1
553-571 (19) TELSLMHFAITNPGWQPPR PA
1
572-581 (10) ESTAFLGFLK PA
1
587-631 (45) DGAAASLAQGGLLPENALFTSIQSLQSESEPLSLIANVVAGSSCR PA
1
646-653 (8) AEVASALR PA
1
654-667 (14) SFSPLQPGQAPTGR PA
1
668-680 (13) AHSTMTGSGVDAR PA
1
681-718 (38) TASSGSSVWEGQLQSLVLSEYASTEMSLHALYMHQLHK PA
1
719-727 (9) QQAQAEPER PA
1
734-751 (18) ESDESGESAPDEGGEGAR PA
1
759-783 (25) SASYPCAAPRPGAPETTALHGGFQR PA
1
785-796 (12) YGGITDPGTVPR PA
1
804-818 (15) LPLGGWAEDGQSASR PA
1
819-838 (20) HPEPVPEEGSEDELPPQVHK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center