Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q7Z3C6-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-35 (35) MLIGEIFELMQFLFVVAFTTFLVSCVDYDILFANK PA
0
36-48 (13) MVNHSLHPTEPVK PA
2
49-64 (16) VTLPDAFLPAQVCSAR PA
2
65-85 (21) IQENGSLITILVIAGVFWIHR PA
2
89-108 (20) FIYNICCYWEIHSFYLHALR PA
2
109-125 (17) IPMSALPYCTWQEVQAR PA
2
132-139 (8) EHQICIHK PA
2
141-150 (10) ELTELDIYHR PA
2
154-164 (11) FQNYMVALVNK PA
2
173-184 (12) LPGLGEAVFFTR PA
2
188-209 (22) YNFELILFWGPGSLFLNEWSLK PA
2
229-260 (32) ILWIGIANFLLCPLILIWQILYAFFSYAEVLK PA
2
262-269 (8) EPGALGAR PA
3
281-292 (12) HFNELEHELQSR PA
2
303-317 (15) YMNCFLSPLLTLLAK PA
2
318-361 (44) NGAFFAGSILAVLIALTIYDEDVLAVEHVLTTVTLLGVTVTVCR PA
2
362-378 (17) SFIPDQHMVFCPEQLLR PA
2
379-397 (19) VILAHIHYMPDHWQGNAHR PA
1
402-411 (10) DEFAQLFQYK PA
1
412-436 (25) AVFILEELLSPIVTPLILIFCLRPR PA
1
437-445 (9) ALEIIDFFR PA
1
446-466 (21) NFTVEVVGVGDTCSFAQMDVR PA
1
467-491 (25) QHGHPQWLSAGQTEASVYQQAEDGK PA
1
492-510 (19) TELSLMHFAITNPGWQPPR PA
1
511-520 (10) ESTAFLGFLK PA
1
526-570 (45) DGAAASLAQGGLLPENALFTSIQSLQSESEPLSLIANVVAGSSCR PA
1
585-592 (8) AEVASALR PA
1
593-606 (14) SFSPLQPGQAPTGR PA
1
607-619 (13) AHSTMTGSGVDAR PA
1
620-657 (38) TASSGSSVWEGQLQSLVLSEYASTEMSLHALYMHQLHK PA
1
658-666 (9) QQAQAEPER PA
1
673-690 (18) ESDESGESAPDEGGEGAR PA
1
698-722 (25) SASYPCAAPRPGAPETTALHGGFQR PA
1
724-735 (12) YGGITDPGTVPR PA
1
743-757 (15) LPLGGWAEDGQSASR PA
1
758-777 (20) HPEPVPEEGSEDELPPQVHK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center