Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q7Z3Z3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
17-28 (12) ESYQQEAPGGPR PA
0
29-61 (33) APGSATTQEPPQLQSTPRPLQEEVPVVRPLQPR PA
0
65-77 (13) GGAGGGAQSQGVK PA
0
78-93 (16) EPGPEAGLHTAPLQER PA
0
95-107 (13) IGGVFQDLVVNTR PA
0
118-133 (16) TGSEGTVVQLLANHFR PA
0
134-144 (11) VISRPQWVAYK PA
0
145-159 (15) YNVDYKPDIEDGNLR PA
0
160-167 (8) TILLDQHR PA
0
174-188 (15) HIFDGNSLLLSRPLK PA
0
192-199 (8) VEWLSTTK PA
0
213-223 (11) ELTPTSPDCLR PA
0
235-243 (9) LLDFEQVGR PA
0
257-287 (31) HGTSLEIWLGYVTSVLQYENSITLCADVSHK PA
0
291-299 (9) IETAYDFIK PA
0
301-311 (11) TSAQAQTGNIR PA
0
318-326 (9) LIGSIVLTK PA
0
341-349 (9) QNPEDTFNK PA
0
355-362 (8) ITYIDYYR PA
0
374-382 (9) QPLLVSQGR PA
0
393-413 (21) EPILLIPQLCHMTGLTDEICK PA
0
438-447 (10) EFINTLQDNK PA
0
451-459 (9) ELLQLWDLK PA
0
460-470 (11) FDTNFLSVPGR PA
0
474-481 (8) NANIVQGR PA
0
486-494 (9) ANSQGDWSR PA
0
498-516 (19) ELPLLNAMPLHSWLILYSR PA
0
527-560 (34) GHLQSVTAPMGITMKPAEMIEVDGDANSYIDTLR PA
0
562-578 (17) YTRPTLQMGMSCLLVFK PA
0
579-588 (10) VICILPNDDK PA
0
602-611 (10) CPIPSQCVVK PA
0
626-633 (8) IAQQMNCK PA
0
648-662 (15) TMFVGIDCFHDIVNR PA
0
665-679 (15) SIAGFVASTNAELTK PA
0
680-688 (9) WYSQCVIQK PA
0
703-710 (8) AALDVWCK PA
0
711-723 (13) NESSMPHSVIVYR PA
0
724-740 (17) DGVGDGQLQALLDHEAK PA
0
748-762 (15) TISPNNFTLAFIVVK PA
0
773-792 (20) HGSNFQNPPPGTVIDVELTR PA
0
793-831 (39) NEWYDFFIVSQSVQDGTVTPTHYNVIYDTIGLSPDTVQR PA
0
832-848 (17) LTYCLCHMYYNLPGIIR PA
0
849-858 (10) VPAPCHYAHK PA
0
859-873 (15) LAYLVGQSIHQEPNR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center