Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q7Z4N8-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-23 (17) LAALLAVLALGTGDPER PA
2
28-39 (12) GDTFSALTSVAR PA
2
72-94 (23) VLSLHEDSTTPVANPLLAFTLIK PA
2
102-114 (13) NVVHSLEASENIR PA
2
123-138 (16) VEQDLPAFEDLEGAAR PA
2
143-152 (10) LQDVYMLNVK PA
2
162-174 (13) VTGSAITDLYSPK PA
2
176-189 (14) LFSLTGDDCFQVGK PA
2
190-212 (23) VAYDMGDYYHAIPWLEEAVSLFR PA
2
220-239 (20) TEDEASLEDALDHLAFAYFR PA
2
240-251 (12) AGNVSCALSLSR PA
2
252-261 (10) EFLLYSPDNK PA
1
273-298 (26) LLAESPNHVVAEAVIQRPNIPHLQTR PA
1
299-338 (40) DTYEGLCQTLGSQPTLYQIPSLYCSYETNSNAYLLLQPIR PA
1
340-362 (23) EVIHLEPYIALYHDFVSDSEAQK PA
1
365-373 (9) ELAEPWLQR PA
1
374-381 (8) SVVASGEK PA
1
410-453 (44) IAALTGLDVRPPYAEYLQVVNYGIGGHYEPHFDHATSPSSPLYR PA
1
460-489 (30) VATFMIYLSSVEAGGATAFIYANLSVPVVR PA
1
490-501 (12) HCFGGTCTGVVK PA
0
502-530 (29) GTVTHFMLAVLSWWEISGWPTSGYMSMDR PA
0
531-541 (11) NSADPAAPALK PA
0
549-558 (10) SWWSPVAFQR PA
0
578-590 (13) RPCQLCLCLANQR PA
0
594-601 (8) GCYQGTLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center