Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q7Z5H5-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-38 (34) YVAVGMILSQTVVGVLGSFSVLLHYLSFYCTGCR PA
0
48-58 (11) HLIVANFLALR PA
0
61-72 (12) GVPQTMAAFGVR PA
0
73-81 (9) YFLNALGCK PA
0
92-112 (21) GVSIGTTCLLSVFQVITVSSR PA
0
126-152 (27) HVGFSVLLCWIVCMLVNIIFPMYVTGK PA
0
153-174 (22) WNYTNITVNEDLGYCSGGGNNK PA
0
181-208 (28) AMLLSFPDVLCLGLMLWVSSSMVCILHR PA
0
231-294 (64) ATQSILILVSTFVSSYTLSCLFQVCMALLDNPNSLLVNTSALMSVCFPTLSPFVLMSCDPSVYR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center