Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q86SE5-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-13 (9) TQTSNVTNK PA
1
23-34 (12) VFIGNLNTAIVK PA
1
36-44 (9) VDIEAIFSK PA
1
48-55 (8) IVGCSVHK PA
4
56-66 (11) GYAFVQYMSER PA
1
70-78 (9) AAVAGENAR PA
1
79-103 (25) VIAGQPLDINMAGEPKPYRPKPGNK PA
1
104-111 (8) RPLSALYR PA
2
116-132 (17) EPFLSVGGYVFDYDYYR PA
2
181-190 (10) STASGSTGSK PA
2
193-200 (8) SDELQTIK PA
2
234-291 (58) QLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center