Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q86SE5-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
13-30 (18) YINMAGEPKPYRPKPGNK PA
0
31-38 (8) RPLSALYR PA
2
43-59 (17) EPFLSVGGYVFDYDYYR PA
2
108-117 (10) STASGSTGSK PA
2
120-127 (8) SDELQTIK PA
2
161-218 (58) QLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center