Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q86SE5-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
9-17 (9) QGEPIMTGK PA
0
18-26 (9) TQTSNVTNK PA
1
36-47 (12) VFIGNLNTAIVK PA
1
49-57 (9) VDIEAIFSK PA
1
61-68 (8) IVGCSVHK PA
4
69-79 (11) GYAFVQYMSER PA
1
83-91 (9) AAVAGENAR PA
1
92-116 (25) VIAGQPLDINMAGEPKPYRPKPGNK PA
1
117-124 (8) RPLSALYR PA
2
129-145 (17) EPFLSVGGYVFDYDYYR PA
2
194-203 (10) STASGSTGSK PA
2
206-213 (8) SDELQTIK PA
2
247-304 (58) QLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center