Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q86T90-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-36 (36) MPDNIIVFSFMFSCVVSDEEQSVVYVPGISAEGNVR PA
0
55-66 (12) VTDASISMESLK PA
1
67-79 (13) GTGDSVDEQNSCR PA
1
121-128 (8) AEQESFEK PA
1
132-142 (11) QLEEQNELIIK PA
1
145-152 (8) EALQLQYR PA
1
153-163 (11) ECQELLSLYQK PA
1
164-171 (8) YLSEQQEK PA
1
172-183 (12) LTMSLSELGAAR PA
1
184-192 (9) MQEQQVSSR PA
1
194-220 (27) STLQCSSVELDGSYLSIARPQTYYQTK PA
1
225-239 (15) SAVQDSASESLIAFR PA
1
240-252 (13) NNSLKPVTLHHPK PA
1
258-272 (15) IPSETTTCNCESPGR PA
1
273-280 (8) KPAVPTEK PA
1
281-289 (9) MPQEELHMK PA
3
290-305 (16) ECPHLKPTPSQCCGHR PA
3
311-325 (15) VHDSHPTNMTPQHPK PA
3
326-335 (10) THPESCSYCR PA
3
336-355 (20) LSWASLVHGGGALQPIETLK PA
3
380-390 (11) LQHLLAQQETK PA
3
395-402 (8) QQQLHQSR PA
3
403-410 (8) LDYNCLLK PA
1
411-425 (15) SNCDGWLLGTSSSIK PA
2
427-437 (11) HQDPPNSGENR PA
2
442-450 (9) TVGFHSHMK PA
2
451-459 (9) DDAQWSCQK PA
2
476-488 (13) DASTSPMPTGSLK PA
2
489-504 (16) DFVTTASPSLQHTTSR PA
1
505-526 (22) YETSLLDLVQSLSPNSAPKPQR PA
1
531-541 (11) EAGAWNHGTFR PA
1
557-573 (17) TPEELEENQILEDIFFI PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center