Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q86TZ1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
10-20 (11) FTIYQIAEMDK PA
0
21-42 (22) GLSELSPMQQALIYSFCENHDK PA
1
43-54 (12) AIEVLDGISWNR PA
1
55-65 (11) AEMTMCALLAK PA
1
83-92 (10) ALDAISHSDK PA
1
93-122 (30) GPDATAISADCLYNLGLCYMEEGNLQMTYK PA
0
123-136 (14) LAITDLTTAISMDK PA
1
137-145 (9) NSYTAFYNR PA
1
154-175 (22) ELQMALTDYGIVLLLDATETVK PA
1
183-200 (18) GLIYVELGQYGFALEDFK PA
1
208-222 (15) TNGSLCHATAMCHHR PA
1
223-238 (16) INEFEEAVNFFTWALK PA
1
239-250 (12) INPCFLDAYVGR PA
1
251-264 (14) GNSYMEYGHDEATK PA
1
273-282 (10) ALHINPAYIK PA
1
285-296 (12) ISFGYNLQAQGK PA
1
300-313 (14) AWNHFTIAIDTDPK PA
1
314-321 (8) NYLAYEGR PA
1
322-343 (22) AVVCLQMGNNFAAMQDINAAMK PA
1
344-354 (11) ISTTAEFLTNR PA
1
355-364 (10) GVIHEFMGHK PA
1
370-380 (11) DYQDAITLNPK PA
1
381-396 (16) YSLAYFNAGNIYFHHR PA
1
397-407 (11) QFSQASDYFSK PA
0
411-422 (12) FDPENEYVLMNR PA
0
423-430 (8) AITNTILK PA
0
437-456 (20) EDFANVIESCPFWAAVYFNR PA
0
457-464 (8) AHFYYCLK PA
0
465-475 (11) QYELAEEDLNK PA
0
476-490 (15) ALSLKPNDALVYNFR PA
0
497-520 (24) IGLIEEAMADYNQALDLEDYASVI PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center