Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q86TZ1-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-25 (22) GLSELSPMQQALIYSFCENHDK PA
1
26-37 (12) AIEVLDGISWNR PA
1
38-48 (11) AEMTMCALLAK PA
1
66-75 (10) ALDAISHSDK PA
1
76-109 (34) GPDATAISADCLYNLGLCYMEEGNLQMAFDSFTK PA
0
113-124 (12) ANPDFAESFYQR PA
0
134-142 (9) DSSILDFNR PA
0
150-157 (8) HYQAYLSR PA
0
203-216 (14) LAITDLTTAISMDK PA
1
217-225 (9) NSYTAFYNR PA
1
234-255 (22) ELQMALTDYGIVLLLDATETVK PA
1
263-280 (18) GLIYVELGQYGFALEDFK PA
1
288-302 (15) TNGSLCHATAMCHHR PA
1
303-318 (16) INEFEEAVNFFTWALK PA
1
319-330 (12) INPCFLDAYVGR PA
1
331-344 (14) GNSYMEYGHDEATK PA
1
353-362 (10) ALHINPAYIK PA
1
365-376 (12) ISFGYNLQAQGK PA
1
380-393 (14) AWNHFTIAIDTDPK PA
1
394-401 (8) NYLAYEGR PA
1
402-423 (22) AVVCLQMGNNFAAMQDINAAMK PA
1
424-434 (11) ISTTAEFLTNR PA
1
435-444 (10) GVIHEFMGHK PA
1
450-460 (11) DYQDAITLNPK PA
1
461-476 (16) YSLAYFNAGNIYFHHR PA
1
477-497 (21) QFSQEESLGLAWSLSLDSFLR PA
0
498-515 (18) TGGATFSSGVNPLQTLHR PA
0
517-529 (13) MSILSPLPPTCPR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center