Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q86U10-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
11-23 (13) LLAVYTGGTIGMR PA
1
24-40 (17) SELGVLVPGTGLAAILR PA
1
41-52 (12) TLPMFHDEEHAR PA
1
55-68 (14) GLSEDTLVLPPASR PA
1
72-101 (30) ILYTVLECQPLFDSSDMTIAEWVCLAQTIK PA
1
103-135 (33) HYEQYHGFVVIHGTDTMAFAASMLSFMLENLQK PA
1
136-154 (19) TVILTGAQVPIHALWSDGR PA
1
155-182 (28) ENLLGALLMAGQYVIPEVCLFFQNQLFR PA
1
194-216 (23) FAAFCSPNLLPLATVGADITINR PA
1
226-242 (17) AGLVVHSSMEQDVGLLR PA
1
243-253 (11) LYPGIPAALVR PA
1
254-261 (8) AFLQPPLK PA
1
262-284 (23) GVVMETFGSGNGPTKPDLLQELR PA
1
290-333 (44) GLVIVNCTHCLQGAVTTDYAAGMAMAGAGVISGFDMTSEAALAK PA
1
334-348 (15) LSYVLGQPGLSLDVR PA
1
358-368 (11) GEMTPPSVEER PA
1
369-397 (29) RPSLQGNTLGGGVSWLLSLSGSQEADALR PA
1
398-443 (46) NALVPSLACAAAHAGDVEALQALVELGSDLGLVDFNGQTPLHAAAR PA
1
444-456 (13) GGHTEAVTMLLQR PA
1
464-476 (13) DTDGFSPLLLAVR PA
1
479-487 (9) HPGVIGLLR PA
1
488-507 (20) EAGASLSTQELEEAGTELCR PA
1
512-573 (62) ADLEGLQVWWQAGADLGQPGYDGHSALHVAEAAGNLAVVAFLQSLEGAVGAQAPCPEVLPGV PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center