Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q86UW1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
14-23 (10) YTADLLEVLK PA
0
24-44 (21) TNYGIPSACFSQPPTAAQLLR PA
0
45-77 (33) ALGPVELALTSILTLLALGSIAIFLEDAVYLYK PA
0
92-110 (19) SSAPTVVSVLCCFGLWIPR PA
0
111-141 (31) SLVLVEMTITSFYAVCFYLLMLVMVEGFGGK PA
0
150-169 (20) DTPMMVHTGPCCCCCPCCPR PA
0
177-191 (15) LQLLMLGPFQYAFLK PA
0
192-241 (50) ITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVSTLLALWTLGIISR PA
0
245-255 (11) LHLGEQNMGAK PA
0
256-291 (36) FALFQVLLILTALQPSIFSVLANGGQIACSPPYSSK PA
0
294-314 (21) SQVMNCHLLILETFLMTVLTR PA
0
324-339 (16) VGYETFSSPDLDLNLK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center