Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q86VD9-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-31 (31) MQICGSSVASVAAGTSFQVLGPVCWQQLDLK PA
0
36-45 (10) VLWGGLSLLR PA
0
46-91 (46) VLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFYPSSSCR PA
0
92-108 (17) SVLFPLLISGSTFWLLR PA
0
109-130 (22) LWEELGPWPGLVSGYALLVGPR PA
0
131-155 (25) LLLTALSFALDGAVYHLAPPMGADR PA
0
156-174 (19) WNALALLSGSYVTLVFYTR PA
0
175-202 (28) TFSNTIEGLLFTWLLVLVSSHVTWGPTR PA
0
213-244 (32) SWLLGGIVAAGFFNRPTFLAFAVVPLYLWGTR PA
0
245-252 (8) GATNPGLK PA
0
257-287 (31) EALVLLPGAALTAAVFVATDSWYFSSPATSR PA
0
288-308 (21) NLVLTPVNFLHYNLNPQNLAR PA
0
315-340 (26) LTHLAVNGFLLFGVLHAQALQAAWQR PA
0
341-355 (15) LQVGLQASAQMGLLR PA
0
368-390 (23) SYLLLLYFMPLALLSAFSHQEAR PA
0
391-413 (23) FLIPLLVPLVLLCSPQTQPVPWK PA
0
414-470 (57) GTVVLFNALGALLFGCLHQGGLVPGLEYLEQVVHAPVLPSTPTHYTLLFTHTYMPPR PA
0
471-500 (30) HLLHLPGLGAPVEVVDMGGTEDWALCQTLK PA
0
505-518 (14) QPACQVAGGPWLCR PA
0
519-528 (10) LFVVTPGTTR PA
0
540-565 (26) NETLLFPHLTLEDPPALSSLLSGAWR PA
0
566-579 (14) DHLSLHIVELGEET PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center