Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q86VP1-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-24 (24) MTSFQEVPLQTSNFAHVIFQNVAK PA
1
25-47 (23) SYLPNAHLECHYTLTPYIHPHPK PA
1
62-108 (47) DYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHK PA
1
113-121 (9) GASTPFQFR PA
1
122-146 (25) ASSPVEELLTMEDEGNSDMLVVTTK PA
1
196-204 (9) CDQLQAEQK PA
3
205-214 (10) GLTEVTQSLK PA
3
231-244 (14) AHQLEEDIVSVTHK PA
3
249-256 (8) ETELDSLK PA
3
267-274 (8) EQLECQLK PA
3
289-296 (8) NTEIENTK PA
3
297-305 (9) LMSEVQTLK PA
3
312-319 (8) ESVITHFK PA
3
325-332 (8) LQLCLAEK PA
3
338-346 (9) TFLLTTSSK PA
3
359-367 (9) AEEQVQATR PA
3
368-375 (8) QEVVFLAK PA
3
376-384 (9) ELSDAVNVR PA
3
387-395 (9) TMADLHTAR PA
3
404-413 (10) QLADAVAELK PA
3
424-432 (9) TDTLEHELR PA
3
442-450 (9) LQMAADHYK PA
3
466-479 (14) LSDQSANNNNVFTK PA
3
487-521 (35) VNDASVNTDPATSASTVDVKPSPSAAEADFDIVTK PA
3
522-529 (8) GQVCEMTK PA
3
578-588 (11) LELAEVQDNYK PA
3
593-600 (8) SLENPAER PA
3
602-621 (20) MEDGADGAFYPDEIQRPPVR PA
2
622-638 (17) VPSWGLEDNVVCSQPAR PA
3
639-653 (15) NFSRPDGLEDSEDSK PA
3
654-670 (17) EDENVPTAPDPPSQHLR PA
3
671-686 (16) GHGTGFCFDSSFDVHK PA
3
688-703 (16) CPLCELMFPPNYDQSK PA
3
704-713 (10) FEEHVESHWK PA
3
714-733 (20) VCPMCSEQFPPDYDQQVFER PA
3
734-747 (14) HVQTHFDQNVLNFD PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center