Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q86WK7-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-15 (15) MTWLVLLGTLLCMLR PA
0
16-29 (14) VGLGTPDSEGFPPR PA
0
30-37 (8) ALHNCPYK PA
0
38-75 (38) CICAADLLSCTGLGLQDVPAELPAATADLDLSHNALQR PA
0
76-88 (13) LRPGWLAPLFQLR PA
0
89-102 (14) ALHLDHNELDALGR PA
0
103-112 (10) GVFVNASGLR PA
0
113-122 (10) LLDLSSNTLR PA
0
127-137 (11) HDLDGLGALEK PA
0
145-157 (13) LVHLDEHAFHGLR PA
0
158-194 (37) ALSHLYLGCNELASFSFDHLHGLSATHLLTLDLSSNR PA
0
195-211 (17) LGHISVPELAALPAFLK PA
0
212-226 (15) NGLYLHNNPLPCDCR PA
0
248-255 (8) EYVCLAFK PA
0
269-294 (26) VFENCSSAPALGLERPEEHLYALVGR PA
0
298-308 (11) LYCNTSVPAMR PA
0
309-320 (12) IAWVSPQQELLR PA
0
326-358 (33) DGSIAVLADGSLAIGNVQEQHAGLFVCLATGPR PA
0
359-408 (50) LHHNQTHEYNVSVHFPRPEPEAFNTGFTTLLGCAVGLVLVLLYLFAPPCR PA
0
419-446 (28) WPQTPSPLQELSAQSSVLSTTPPDAPSR PA
0
453-461 (9) HVVFLEPGR PA
0
468-487 (20) VQLAVAEEFDLYNPGGLQLK PA
0
488-504 (17) AGSESASSIGSEGPMTT PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center