Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q86XR8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-23 (23) MAAASVSAASGSHLSNSFAEPSR PA
2
31-51 (21) HSSSPYVVYPSDKPFLNSDLR PA
4
53-67 (15) SPSKPTLAYPESNSR PA
4
88-95 (8) IQAEESVK PA
4
107-115 (9) VLDEQIQER PA
4
125-139 (15) HNQELTSQLLAAENK PA
4
176-188 (13) QHDQTHVQSQLEK PA
4
189-198 (10) LDLLEQEYNK PA
4
199-208 (10) LTTMQALAEK PA
4
217-224 (8) LHEEEQER PA
4
231-242 (12) AAELQTGLETNR PA
4
249-257 (9) ATPCVPNAR PA
4
274-283 (10) NYFGAQPHYR PA
2
284-295 (12) LCLGDMPFVAGK PA
2
296-315 (20) STSPSHAVVANVQLVLHLMK PA
3
326-334 (9) VINSIPLAK PA
3
346-383 (38) LSVTPPSSNGINEELSEVLQTLQDEFGQMSFDHQQLAK PA
3
384-394 (11) LIQESPTVELK PA
3
397-407 (11) LECELEALVGR PA
3
454-462 (9) SGITGTTNK PA
3
483-500 (18) DMQSIQNSLQSSSLCWDY PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center