Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q86XR8-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-14 (10) IDNSFAEPSR PA
1
22-42 (21) HSSSPYVVYPSDKPFLNSDLR PA
4
44-58 (15) SPSKPTLAYPESNSR PA
4
79-86 (8) IQAEESVK PA
4
98-106 (9) VLDEQIQER PA
4
116-130 (15) HNQELTSQLLAAENK PA
4
167-179 (13) QHDQTHVQSQLEK PA
4
180-189 (10) LDLLEQEYNK PA
4
190-199 (10) LTTMQALAEK PA
4
208-215 (8) LHEEEQER PA
4
222-233 (12) AAELQTGLETNR PA
4
240-248 (9) ATPCVPNAR PA
4
265-274 (10) NYFGAQPHYR PA
2
275-286 (12) LCLGDMPFVAGK PA
2
287-306 (20) STSPSHAVVANVQLVLHLMK PA
3
317-325 (9) VINSIPLAK PA
3
337-374 (38) LSVTPPSSNGINEELSEVLQTLQDEFGQMSFDHQQLAK PA
3
375-385 (11) LIQESPTVELK PA
3
388-398 (11) LECELEALVGR PA
3
445-453 (9) SGITGTTNK PA
3
474-488 (15) DMQSIQNSLQSSSLC PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center