Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q86YE8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-14 (14) MFPVLEPHQVGLIR PA
0
20-31 (12) TMTCFQELVTFR PA
0
32-39 (8) DVAIDFSR PA
2
40-50 (11) QEWEYLDPNQR PA
0
55-62 (8) DVMLENYR PA
74
63-83 (21) NLVSLGGHSISKPVVVDLLER PA
0
93-129 (37) EETQFTDLDLQCEIISYIEVPTYETDISSTQLQSIYK PA
1
143-154 (12) FSSGYQLILHHR PA
3
155-165 (11) FHVIERPYECK PA
3
173-182 (10) SGYQLTLHQR PA
3
183-197 (15) FHTGEKPYECTECGK PA
3
201-210 (10) SGYQLTVHQR PA
3
226-238 (13) AFIYASHIVQHER PA
3
239-253 (15) IHTGGKPYECQECGR PA
3
254-262 (9) AFSQGGHLR PA
3
267-275 (9) VHTGEKPYK PA
80
287-306 (20) SNLVEHGQFHTDEKPYICEK PA
3
314-322 (9) GHQLTVHQR PA
3
338-350 (13) GYTTASYFLLHQR PA
3
354-361 (8) GGKPYECK PA
3
376-384 (9) HQNIHTGEK PA
3
407-417 (11) THTGEKPYECK PA
68
422-430 (9) AFSLYGYLK PA
3
460-467 (8) HQNIHTGK PA
4
469-477 (9) LFECQECGK PA
3
478-489 (12) AYSTGSNLIQHR PA
3
491-499 (9) THTGEKPYK PA
107
506-518 (13) TFSLHGYLNQHQK PA
3
519-529 (11) IHTGMKPYECK PA
3
540-557 (18) NLTLHQSIHTDEKPFECK PA
3
566-579 (14) SSHLTAHQSIHADK PA
3
593-602 (10) MYGYLTQHQK PA
3
603-613 (11) IHTGGKPYECK PA
5
622-630 (9) ASNLVQHER PA
3
631-641 (11) IHTGEKPYVCK PA
7
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center