Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q86YE8-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-41 (37) EETQFTDLDLQCEIISYIEVPTYETDISSTQLQSIYK PA
1
55-66 (12) FSSGYQLILHHR PA
3
67-77 (11) FHVIERPYECK PA
3
85-94 (10) SGYQLTLHQR PA
3
95-109 (15) FHTGEKPYECTECGK PA
3
113-122 (10) SGYQLTVHQR PA
3
138-150 (13) AFIYASHIVQHER PA
3
151-165 (15) IHTGGKPYECQECGR PA
3
166-174 (9) AFSQGGHLR PA
3
179-187 (9) VHTGEKPYK PA
80
199-218 (20) SNLVEHGQFHTDEKPYICEK PA
3
226-234 (9) GHQLTVHQR PA
3
250-262 (13) GYTTASYFLLHQR PA
3
266-273 (8) GGKPYECK PA
3
288-296 (9) HQNIHTGEK PA
3
319-329 (11) THTGEKPYECK PA
68
334-342 (9) AFSLYGYLK PA
3
372-379 (8) HQNIHTGK PA
4
381-389 (9) LFECQECGK PA
3
390-401 (12) AYSTGSNLIQHR PA
3
403-411 (9) THTGEKPYK PA
107
418-430 (13) TFSLHGYLNQHQK PA
3
431-441 (11) IHTGMKPYECK PA
3
452-469 (18) NLTLHQSIHTDEKPFECK PA
3
478-491 (14) SSHLTAHQSIHADK PA
3
505-514 (10) MYGYLTQHQK PA
3
515-525 (11) IHTGGKPYECK PA
5
534-542 (9) ASNLVQHER PA
3
543-553 (11) IHTGEKPYVCK PA
7
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center