Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q86YE8-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-42 (36) NLVSLDLDLQCEIISYIEVPTYETDISSTQLQSIYK PA
0
56-67 (12) FSSGYQLILHHR PA
3
68-78 (11) FHVIERPYECK PA
3
86-95 (10) SGYQLTLHQR PA
3
96-110 (15) FHTGEKPYECTECGK PA
3
114-123 (10) SGYQLTVHQR PA
3
139-151 (13) AFIYASHIVQHER PA
3
152-166 (15) IHTGGKPYECQECGR PA
3
167-175 (9) AFSQGGHLR PA
3
180-188 (9) VHTGEKPYK PA
80
200-219 (20) SNLVEHGQFHTDEKPYICEK PA
3
227-235 (9) GHQLTVHQR PA
3
251-263 (13) GYTTASYFLLHQR PA
3
267-274 (8) GGKPYECK PA
3
289-297 (9) HQNIHTGEK PA
3
320-330 (11) THTGEKPYECK PA
68
335-343 (9) AFSLYGYLK PA
3
373-380 (8) HQNIHTGK PA
4
382-390 (9) LFECQECGK PA
3
391-402 (12) AYSTGSNLIQHR PA
3
404-412 (9) THTGEKPYK PA
107
419-431 (13) TFSLHGYLNQHQK PA
3
432-442 (11) IHTGMKPYECK PA
3
453-470 (18) NLTLHQSIHTDEKPFECK PA
3
479-492 (14) SSHLTAHQSIHADK PA
3
506-515 (10) MYGYLTQHQK PA
3
516-526 (11) IHTGGKPYECK PA
5
535-543 (9) ASNLVQHER PA
3
544-554 (11) IHTGEKPYVCK PA
7
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center