Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8IU54-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-32 (32) MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGK PA
0
41-51 (11) SLSPQELASFK PA
0
55-62 (8) DALEESLK PA
0
65-80 (16) NWSCSSPVFPGNWDLR PA
0
86-100 (15) ERPVALEAELALTLK PA
1
101-143 (43) VLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPR PA
0
160-175 (16) ESAGCLEASVTFNLFR PA
0
183-192 (10) YVADGNLCLR PA
0
193-200 (8) TSTHPEST PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center