Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8IVV8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-24 (17) CALVVLCAFQLVAALER PA
0
25-58 (34) QVFDFLGYQWAPILANFVHIIIVILGLFGTIQYR PA
0
61-91 (31) YVMVYTLWAAVWVTWNVFIICFYLEVGGLLK PA
0
92-102 (11) DSELLTFSLSR PA
0
111-202 (92) WPGCLHEEVPAVGLGAPHGQALVSGAGCALEPSYVEALHSCLQILIALLGFVCGCQVVSVFTEEEDSFDFIGGFDPFPLYHVNEKPSSLLSK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center