Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8IWE2-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-14 (14) MLSAITNVVQNTGK PA
0
15-29 (15) SVLTGGLDALEFIGK PA
1
31-43 (13) TMNVLAESDPGFK PA
1
52-60 (9) TVSLSQMLR PA
1
70-78 (9) LAQQLTMER PA
1
79-108 (30) TAHYGMLFDEYQGLSHLEALEILSNESESK PA
1
109-120 (12) VQSFLASLDGEK PA
1
139-154 (16) ELENEENQEEQGLEEK PA
1
161-177 (17) MLTELLFELHVAATPDK PA
1
185-202 (18) AHDWVEEDQTVVSVDVAK PA
1
217-224 (8) SQDPQEDK PA
1
232-250 (19) TIEEVYMSSIESLAEVTAR PA
1
258-277 (20) VAELILHGQEEEKPAQDQAK PA
1
282-295 (14) LTTAMCNEVASLSK PA
1
297-308 (12) FTNSLTTVGSNK PA
1
310-353 (44) AEVLNPMISSVLLEGCNSTTYIQDAFQLLLPVLQVSHIQTSCLK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center