Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8IX15-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
23-31 (9) SEGTMPPNK PA
1
32-74 (43) EASGLSSSPAGLICLPPISEELQLVWTQAAQTSELDSNEHLLK PA
1
75-93 (19) TFSYFPYPSLADIALLCLR PA
1
112-125 (14) CGISWSSEEIEETR PA
1
139-181 (43) SLLSFTHHAGRPPEEVPPPPVPAPEQVGIGIGPPTLSKPTQTK PA
1
185-202 (18) VEPEEPSQMPPLPQSHQK PA
1
205-232 (28) ESLMTPGSGAFPYQSDFWQHLQSSGLSK PA
1
238-262 (25) GPNQSHGIGTASWNHSTTVPQPQAR PA
1
263-276 (14) DKPPPIALIASSCK PA
1
277-338 (62) EESASSVTPSSSSTSSSFQVLANGATAASKPLQPLGCVPQSVSPSEQALPPHLEPAWPQGLR PA
1
346-358 (13) VGPTEYLSPDMQR PA
1
375-384 (10) SFFLQCQWAR PA
1
391-410 (20) LEQITGLPRPEIIQWFGDTR PA
1
423-445 (23) DNAVPGAPSFQDPAIPTPPPSTR PA
1
451-470 (20) AETPPLPIPPPPPDIQPLER PA
1
471-479 (9) YWAAHQQLR PA
1
480-491 (12) ETDIPQLSQASR PA
1
492-504 (13) LSTQQVLDWFDSR PA
1
505-552 (48) LPQPAEVVVCLDEEEEEEEEELPEDDEEEEEEEEEDDDDDDDDVIIQD PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center